Cactin Antibody
| Name | Cactin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86678 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SLDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Cactin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CACTIN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Cactin Antibody [NBP1-86678] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17350_Cactin-Antibody-Western-Blot-NBP1-86678-img0005.jpg)
Western Blot: Cactin Antibody [NBP1-86678] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: Cactin Antibody [NBP1-86678] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17351_Cactin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86678-img0006.jpg)
Immunocytochemistry/Immunofluorescence: Cactin Antibody [NBP1-86678] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.
![Immunohistochemistry-Paraffin: Cactin Antibody [NBP1-86678] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17352_Cactin-Antibody-Immunohistochemistry-Paraffin-NBP1-86678-img0002.jpg)
Immunohistochemistry-Paraffin: Cactin Antibody [NBP1-86678] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine glandular cells.