HMGCS1 Antibody

Name HMGCS1 Antibody
Supplier Novus Biologicals
Catalog NBP2-14094
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: TLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAPDVFAENMKLRE DTHHLVNYIPQGSIDSLFEGTWY
Purity/Format Immunogen affinity purified
Blocking Peptide HMGCS1 Protein
Description Rabbit Polyclonal
Gene HMGCS1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.