CAPZB Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-85922
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: CAPZB Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: CAPZB
• Conjugate: Unconjugated

Product images

Western Blot: CAPZB Antibody [NBP1-85922] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: CAPZB Antibody [NBP1-85922] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles.

Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Western Blot: CAPZB Antibody [NBP1-85922] - Analysis in human cell line A-431.