HIF-3 alpha Antibody
| Name | HIF-3 alpha Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89977 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HIF-3 alpha Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HIF3A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: HIF-3 alpha Antibody [NBP1-89977] - Immunohistochemical staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10004_HIF-3-alpha-Antibody-Immunohistochemistry-NBP1-89977-img0001.jpg)
Immunohistochemistry: HIF-3 alpha Antibody [NBP1-89977] - Immunohistochemical staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.