RGC32 Antibody
| Name | RGC32 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90039 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RGC32 Protein |
| Description | Rabbit Polyclonal |
| Gene | RGCC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RGC32 Antibody [NBP1-90039] - Analysis in human lung tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22609_RGC32%2520Antibody-Western%2520Blot-NBP1-90039-img0007.jpg)
![Immunohistochemistry-Paraffin: RGC32 Antibody [NBP1-90039] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22610_RGC32-Antibody-Immunohistochemistry-Paraffin-NBP1-90039-img0002.jpg)