SH3PXD2A Antibody
| Name | SH3PXD2A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90454 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SH3PXD2A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SH3PXD2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SH3PXD2A Antibody [NBP1-90454] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10202_SH3PXD2A-Antibody-Western-Blot-NBP1-90454-img0008.jpg)
Western Blot: SH3PXD2A Antibody [NBP1-90454] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunohistochemistry-Paraffin: SH3PXD2A Antibody [NBP1-90454] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10203_SH3PXD2A-Antibody-Immunohistochemistry-Paraffin-NBP1-90454-img0009.jpg)
Immunohistochemistry-Paraffin: SH3PXD2A Antibody [NBP1-90454] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
![Western Blot: SH3PXD2A Antibody [NBP1-90454] - Analysis in human cell line HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10204_SH3PXD2A-Antibody-Western-Blot-NBP1-90454-img0007.jpg)
Western Blot: SH3PXD2A Antibody [NBP1-90454] - Analysis in human cell line HeLa.