RASGRP 4 Antibody
| Name | RASGRP 4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92317 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDELLEKCIQSFDSAGSLCHEDHMLNMVL |
| Description | Rabbit Polyclonal |
| Gene | RASGRP4 |
| Supplier Page | Shop |
Product images
![Western Blot: RASGRP 4 Antibody [NBP1-92317] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25108_RASGRP%25204%2520Antibody-Western%2520Blot-NBP1-92317-img0005.jpg)
Western Blot: RASGRP 4 Antibody [NBP1-92317] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: RASGRP 4 Antibody [NBP1-92317] - Staining of human cell line A-431 shows positivity in nucleus & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25109_RASGRP-4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92317-img0004.jpg)
Immunocytochemistry/Immunofluorescence: RASGRP 4 Antibody [NBP1-92317] - Staining of human cell line A-431 shows positivity in nucleus & cytoplasm.
![Immunohistochemistry-Paraffin: RASGRP 4 Antibody [NBP1-92317] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25110_RASGRP-4-Antibody-Immunohistochemistry-Paraffin-NBP1-92317-img0002.jpg)
Immunohistochemistry-Paraffin: RASGRP 4 Antibody [NBP1-92317] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.