Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody

Name Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody
Supplier Novus Biologicals
Catalog NBP1-91982
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:NQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLH
Purity/Format Immunogen affinity purified
Blocking Peptide Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene HS2ST1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.