HPSE2 Antibody
| Name | HPSE2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93691 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKQQFSNTY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HPSE2 Protein |
| Description | Rabbit Polyclonal |
| Gene | HPSE2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HPSE2 Antibody [NBP1-93691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17017_HPSE2-Antibody-Western-Blot-NBP1-93691-img0006.jpg)
Western Blot: HPSE2 Antibody [NBP1-93691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
![Immunocytochemistry/Immunofluorescence: HPSE2 Antibody [NBP1-93691] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17018_HPSE2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93691-img0004.jpg)
Immunocytochemistry/Immunofluorescence: HPSE2 Antibody [NBP1-93691] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
![Immunohistochemistry-Paraffin: HPSE2 Antibody [NBP1-93691] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17019_HPSE2-Antibody-Immunohistochemistry-Paraffin-NBP1-93691-img0002.jpg)
Immunohistochemistry-Paraffin: HPSE2 Antibody [NBP1-93691] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.