Rab11 Antibody
| Name | Rab11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58933 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RAB11B(RAB11B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB11B. Peptide sequence IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAB11B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Rab11 Antibody [NBP1-58933] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3_Rab11-Antibody-Western-Blot-NBP1-58933-img0003.jpg)
![Western Blot: Rab11 Antibody [NBP1-58933] - Human NT-2 cells and Mouse WT brain, concentration 2ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4_Rab11-Antibody-Western-Blot-NBP1-58933-img0002.jpg)