RABL4 Antibody
| Name | RABL4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58928 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RABL4(RAB, member of RAS oncogene family-like 4) The peptide sequence was selected from the C terminal of RABL4. Peptide sequence RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | IFT27 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RABL4 Antibody [NBP1-58928] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24464_RABL4-Antibody-Western-Blot-NBP1-58928-img0002.jpg)
Western Blot: RABL4 Antibody [NBP1-58928] - 721_B cell lysate, concentration 0.2-1 ug/ml.
![Immunocytochemistry/Immunofluorescence: RABL4 Antibody [NBP1-58928] - Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes surrounding the portal vein only, signal is strong but tissue abundance is low](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24465_RABL4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-58928-img0003.jpg)
Immunocytochemistry/Immunofluorescence: RABL4 Antibody [NBP1-58928] - Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes surrounding the portal vein only, signal is strong but tissue abundance is low