DC-SIGNR/CD299/CLEC4M Antibody
| Name | DC-SIGNR/CD299/CLEC4M Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59182 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CLEC4M(C-type lectin domain family 4, member M) The peptide sequence was selected from the N terminal of CLEC4M. Peptide sequence LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CLEC4M |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DC-SIGNR/CD299/CLEC4M Antibody [NBP1-59182] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14333_DC-SIGNR-CD299-CLEC4M-Antibody-Western-Blot-NBP1-59182-img0001.jpg)
Western Blot: DC-SIGNR/CD299/CLEC4M Antibody [NBP1-59182] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
![Immunohistochemistry-Paraffin: DC-SIGNR/CD299/CLEC4M Antibody [NBP1-59182] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14334_DC-SIGNR-CD299-CLEC4M-Antibody-Immunohistochemistry-Paraffin-NBP1-59182-img0003.jpg)
Immunohistochemistry-Paraffin: DC-SIGNR/CD299/CLEC4M Antibody [NBP1-59182] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.