hydroxysteroid (17-beta) dehydrogenase 11 Antibody
| Name | hydroxysteroid (17-beta) dehydrogenase 11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57081 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC-P |
| Species Reactivities | Human, Monkey |
| Antigen | Synthetic peptides corresponding to HSD17B11 (hydroxysteroid (17-beta) dehydrogenase 11) The peptide sequence was selected from the N terminal of HSD17B11. Peptide sequence TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HSD17B11 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-57081] - COLO205 cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19486_hydroxysteroid-(17-beta)-dehydrogenase-11-Antibody-Western-Blot-NBP1-57081-img0002.jpg)
Western Blot: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-57081] - COLO205 cells lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-57081] - Monkey adrenal gland.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19487_hydroxysteroid-(17-beta)-dehydrogenase-11-Antibody-Immunohistochemistry-Paraffin-NBP1-57081-img0004.jpg)
Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-57081] - Monkey adrenal gland.
![Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-57081] - Monkey vagina.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19488_hydroxysteroid-(17-beta)-dehydrogenase-11-Antibody-Immunohistochemistry-Paraffin-NBP1-57081-img0003.jpg)
Immunohistochemistry-Paraffin: hydroxysteroid (17-beta) dehydrogenase 11 Antibody [NBP1-57081] - Monkey vagina.