Matriptase 2 Antibody
| Name | Matriptase 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57098 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMPRSS6(transmembrane protease, serine 6) The peptide sequence was selected from the N terminal of TMPRSS6. Peptide sequence LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMPRSS6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Matriptase 2 Antibody [NBP1-57098] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14380_Matriptase-2-Antibody-Western-Blot-NBP1-57098-img0004.jpg)
![Immunohistochemistry-Paraffin: Matriptase 2 Antibody [NBP1-57098] - Human Liver tissue, 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14381_Matriptase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-57098-img0003.jpg)