UPF3B Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57232
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to UPF3B (UPF3 regulator of nonsense transcripts homolog B (yeast)) The peptide sequence was selected from the N terminal of UPF3B. Peptide sequence MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: UPF3B
• Conjugate: Unconjugated