APOBEC3B Antibody

Name APOBEC3B Antibody
Supplier Novus Biologicals
Catalog NBP1-57516
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to APOBEC3B(apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B) The peptide sequence was selected from the N terminal of APOBEC3B (NP_004891). Peptide sequence: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTI
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene APOBEC3B
Conjugate Unconjugated
Supplier Page Shop

Product images