VTA1 Antibody

Name VTA1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57637
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to VTA1(Vps20-associated 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VTA1 (NP_057569). Peptide sequence KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene VTA1
Conjugate Unconjugated
Supplier Page Shop

Product images