FAM62B Antibody
| Name | FAM62B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59988 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IP |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FAM62B(family with sequence similarity 62 (C2 domain containing) member B) The peptide sequence was selected from the middle region of FAM62B. Peptide sequence NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEG |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ESYT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FAM62B Antibody [NBP1-59988] - HT1080 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7384_FAM62B%2520Antibody-Western%2520Blot-NBP1-59988-img0002.jpg)
![Immunoprecipitation: FAM62B Antibody [NBP1-59988] - Titration: 1 ug/ml Positive Control: HEK-293T cells](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7385_FAM62B%2520Antibody-Immunoprecipitation-NBP1-59988-img0001.jpg)