CHT1 Antibody

Name CHT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62339
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC5A7(solute carrier family 5 (choline transporter), member 7) The peptide sequence was selected from the middle region of SLC5A7. Peptide sequence DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC5A7
Conjugate Unconjugated
Supplier Page Shop

Product images