Name | MTRR Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57749 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase) The peptide sequence was selected from the N terminal of MTRR)(50ug). Peptide sequence YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFA |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | MTRR |
Supplier Page | Shop |