MTRR Antibody

Name MTRR Antibody
Supplier Novus Biologicals
Catalog NBP1-57749
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase) The peptide sequence was selected from the N terminal of MTRR)(50ug). Peptide sequence YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFA
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene MTRR
Supplier Page Shop

Product images