Name | BLAP75 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58133 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RMI1(RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of RMI1 (NP_079221). Peptide sequence DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | RMI1 |
Conjugate | Unconjugated |
Supplier Page | Shop |