BLAP75 Antibody

Name BLAP75 Antibody
Supplier Novus Biologicals
Catalog NBP1-58133
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RMI1(RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of RMI1 (NP_079221). Peptide sequence DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RMI1
Conjugate Unconjugated
Supplier Page Shop

Product images