Name | KRAS Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58261 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Rabbit, Zebrafish |
Antigen | Synthetic peptide directed towards the N terminal of human KRAS (NP_203524). Peptide sequence TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC. |
Purity/Format | Affinity purified |
Description | Rabbit Polyclonal |
Gene | NRAS |
Supplier Page | Shop |