KRAS Antibody

Name KRAS Antibody
Supplier Novus Biologicals
Catalog NBP1-58261
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Rabbit, Zebrafish
Antigen Synthetic peptide directed towards the N terminal of human KRAS (NP_203524). Peptide sequence TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene NRAS
Supplier Page Shop

Product images