RNF6 Antibody
| Name | RNF6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80251 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Antigen | Synthetic peptide directed towards the N terminal of mouse RNF6. Peptide sequence MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | Rnf6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RNF6 Antibody [NBP1-80251] - Titration: 1.25ug/ml Positive Control: SP2/0 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19995_RNF6%2520Antibody-Western%2520Blot-NBP1-80251-img0004.jpg)
Western Blot: RNF6 Antibody [NBP1-80251] - Titration: 1.25ug/ml Positive Control: SP2/0 cell lysate.
![Immunohistochemistry-Paraffin: RNF6 Antibody [NBP1-80251] - Mouse intestine, 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19996_RNF6%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80251-img0001.jpg)
Immunohistochemistry-Paraffin: RNF6 Antibody [NBP1-80251] - Mouse intestine, 4-8ug/ml.
![Immunohistochemistry-Paraffin: RNF6 Antibody [NBP1-80251] - Mouse Pancreas tissue, islet cell (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19997_RNF6%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80251-img0003.jpg)
Immunohistochemistry-Paraffin: RNF6 Antibody [NBP1-80251] - Mouse Pancreas tissue, islet cell (Indicated with Arrows) 4-8ug/ml.