Name | Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62545 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the N terminal of TMPRSS11D. Peptide sequence RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | TMPRSS11D |
Conjugate | Unconjugated |
Supplier Page | Shop |