Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody
| Name | Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62545 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the N terminal of TMPRSS11D. Peptide sequence RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TMPRSS11D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody [NBP1-62545] - HepG2 cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24504_Airway-Trypsin-like-Protease-HAT-TMPRSS11D-Antibody-Western-Blot-NBP1-62545-img0001.jpg)
![Immunohistochemistry-Paraffin: Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody [NBP1-62545] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24505_Airway-Trypsin-like-Protease-HAT-TMPRSS11D-Antibody-Immunohistochemistry-Paraffin-NBP1-62545-img0002.jpg)