PURL Antibody
| Name | PURL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70692 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PFAS(phosphoribosylformylglycinamidine synthase (FGAR amidotransferase)) The peptide sequence was selected from the N terminal of PFAS. Peptide sequence ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PFAS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PURL Antibody [NBP1-70692] - 293T Whole Cell lysates, Antibody Dilution: 0.05 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24883_PURL-Antibody-Western-Blot-NBP1-70692-img0007.jpg)
Western Blot: PURL Antibody [NBP1-70692] - 293T Whole Cell lysates, Antibody Dilution: 0.05 ug/ml.
![Western Blot: PURL Antibody [NBP1-70692] - 1. Human Skin Fibroblasts (100ug) 2. HEK273 cells (20ug) 3. HeLa skin cells(20ug) at 1:2,000.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24884_PURL-Antibody-Western-Blot-NBP1-70692-img0005.jpg)
Western Blot: PURL Antibody [NBP1-70692] - 1. Human Skin Fibroblasts (100ug) 2. HEK273 cells (20ug) 3. HeLa skin cells(20ug) at 1:2,000.
![Western Blot: PURL Antibody [NBP1-70692] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24885_PURL-Antibody-Western-Blot-NBP1-70692-img0006.jpg)
Western Blot: PURL Antibody [NBP1-70692] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.