USP30 Antibody

Name USP30 Antibody
Supplier Novus Biologicals
Catalog NBP1-79335
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human USP30The immunogen for this antibody is USP30. Peptide sequence SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene USP30
Conjugate Unconjugated
Supplier Page Shop

Product images