SMYD3 Antibody
| Name | SMYD3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79393 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human SMYD3The immunogen for this antibody is SMYD3. Peptide sequence PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SMYD3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SMYD3 Antibody [NBP1-79393] - Quiescent human colon carcinoma cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7105_SMYD3-Antibody-Western-Blot-NBP1-79393-img0003.jpg)
Western Blot: SMYD3 Antibody [NBP1-79393] - Quiescent human colon carcinoma cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
![Western Blot: SMYD3 Antibody [NBP1-79393] - Human Stomach, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7106_SMYD3-Antibody-Western-Blot-NBP1-79393-img0002.jpg)
Western Blot: SMYD3 Antibody [NBP1-79393] - Human Stomach, concentration 0.2-1 ug/ml.