MED19 Antibody
| Name | MED19 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79597 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Rat |
| Antigen | Synthetic peptide corresponding to a region of Rat MED19 (NP_001101211). Peptide sequence MRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMID. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MED19 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MED19 Antibody [NBP1-79597] - Rat Liver Lysate, probed with MED19 Antibody, diluted at 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7095_MED19%2520Antibody-Western%2520Blot-NBP1-79597-img0001.jpg)
Western Blot: MED19 Antibody [NBP1-79597] - Rat Liver Lysate, probed with MED19 Antibody, diluted at 1 ug/ml.