ZnT-8/SLC30A8 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59424
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC30A8(solute carrier family 30 (zinc transporter), member 8) The peptide sequence was selected from the middle region of SLC30A8. Peptide sequence LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC30A8
• Conjugate: Unconjugated