NNT Antibody
| Name | NNT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59612 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NNT(nicotinamide nucleotide transhydrogenase) The peptide sequence was selected from the N terminal of NNT. Peptide sequence IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NNT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NNT Antibody [NBP1-59612] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B:Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/Lane, Gel Concentration: 0.12](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7394_NNT-Antibody-Western-Blot-NBP1-59612-img0004.jpg)
Western Blot: NNT Antibody [NBP1-59612] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B:Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/Lane, Gel Concentration: 0.12
![Western Blot: NNT Antibody [NBP1-59612] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7395_NNT-Antibody-Western-Blot-NBP1-59612-img0003.jpg)
Western Blot: NNT Antibody [NBP1-59612] - Human Liver cell lysate, concentration 0.2-1 ug/ml.