AP3M2 Antibody

Name AP3M2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56624
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AP3M2(adaptor-related protein complex 3, mu 2 subunit) The peptide sequence was selected from the middle region of AP3M2 (NP_006794). Peptide sequence VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AP3M2
Conjugate Unconjugated
Supplier Page Shop

Product images