Name | AP3M2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56624 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to AP3M2(adaptor-related protein complex 3, mu 2 subunit) The peptide sequence was selected from the middle region of AP3M2 (NP_006794). Peptide sequence VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | AP3M2 |
Conjugate | Unconjugated |
Supplier Page | Shop |