Argonaute 3 Antibody

Name Argonaute 3 Antibody
Supplier Novus Biologicals
Catalog NBP1-54932
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EIF2C3(eukaryotic translation initiation factor 2C, 3) The peptide sequence was selected from the N terminal of EIF2C3. Peptide sequence MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AGO3
Conjugate Unconjugated
Supplier Page Shop

Product images