RTKN Antibody

Name RTKN Antibody
Supplier Novus Biologicals
Catalog NBP1-54973
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RTKN(rhotekin) The peptide sequence was selected from the N terminal of RTKN (NP_001015055). Peptide sequence DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RTKN
Conjugate Unconjugated
Supplier Page Shop

Product images