Name | TRIM72 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55029 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB IP |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to TRIM72(tripartite motif-containing 72) The peptide sequence was selected from the N terminal of TRIM72 (NP_001008275). Peptide sequence CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | TRIM72 |
Conjugate | Unconjugated |
Supplier Page | Shop |