| Name | TRIM72 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55029 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IP |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TRIM72(tripartite motif-containing 72) The peptide sequence was selected from the N terminal of TRIM72 (NP_001008275). Peptide sequence CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TRIM72 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |