HACE1 Antibody

Name HACE1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55062
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HACE1(HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1) The peptide sequence was selected from the middle region of HACE1. Peptide sequence DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HACE1
Conjugate Unconjugated
Supplier Page Shop

Product images