Name | HACE1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55062 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to HACE1(HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1) The peptide sequence was selected from the middle region of HACE1. Peptide sequence DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVL |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | HACE1 |
Conjugate | Unconjugated |
Supplier Page | Shop |