GNL3L Antibody

Name GNL3L Antibody
Supplier Novus Biologicals
Catalog NBP1-55240
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF
Species Reactivities Human
Antigen Synthetic peptides corresponding to GNL3L(guanine nucleotide binding protein-like 3 (nucleolar)-like) The peptide sequence was selected from the N terminal of GNL3L. Peptide sequence MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GNL3L
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.