GABARAPL1 Antibody
| Name | GABARAPL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55202 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GABARAPL1(GABA(A) receptor-associated protein like 1) The peptide sequence was selected from the N terminal of GABARAPL1 (NP_113600). Peptide sequence MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GABARAPL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GABARAPL1 Antibody [NBP1-55202] - Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19959_GABARAPL1%2520Antibody-Western%2520Blot-NBP1-55202-img0005.jpg)
Western Blot: GABARAPL1 Antibody [NBP1-55202] - Hela Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
![Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain lysate tissue at an Antibody concentration of 5.0 ug/ml using anti-GABARAPL1 Antibody (ARP55398_P050).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19960_GABARAPL1-Antibody-Immunohistochemistry-Paraffin-NBP1-55202-img0004.jpg)
Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain lysate tissue at an Antibody concentration of 5.0 ug/ml using anti-GABARAPL1 Antibody (ARP55398_P050).
![Western Blot: GABARAPL1 Antibody [NBP1-55202] - Transfected 293T tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19961_GABARAPL1-Antibody-Western-Blot-NBP1-55202-img0001.jpg)
Western Blot: GABARAPL1 Antibody [NBP1-55202] - Transfected 293T tissue lysate at a concentration of 1ug/ml.
![Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain Tissue, antibody concentration 5ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19962_GABARAPL1-Antibody-Immunohistochemistry-Paraffin-NBP1-55202-img0002.jpg)
Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human Brain Tissue, antibody concentration 5ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.
![Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human spleen.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19963_GABARAPL1-Antibody-Immunohistochemistry-Paraffin-NBP1-55202-img0003.jpg)
Immunohistochemistry-Paraffin: GABARAPL1 Antibody [NBP1-55202] - Human spleen.