ACOT2 Antibody
| Name | ACOT2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70402 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ACOT2(acyl-CoA thioesterase 2) The peptide sequence was selected form the middle region of ACOT2 (NP_006812). Peptide sequence SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ACOT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ACOT2 Antibody [NBP1-70402] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24615_ACOT2-Antibody-Western-Blot-NBP1-70402-img0004.jpg)
![Western Blot: ACOT2 Antibody [NBP1-70402] - Human Fetal Liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24616_ACOT2-Antibody-Western-Blot-NBP1-70402-img0003.jpg)