TIMM8A Antibody (2F11)
| Name | TIMM8A Antibody (2F11) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001678-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2F11 |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | TIMM8A (NP_004076, 9 a.a. - 97 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | TIMM8A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - TIMM8A monoclonal antibody (M01), clone 2F11 Analysis of TIMM8A expression in HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/18397_TIMM8A-Antibody-(2F11)-Western-Blot-H00001678-M01-img0007.jpg)
Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - TIMM8A monoclonal antibody (M01), clone 2F11 Analysis of TIMM8A expression in HeLa.
![Immunohistochemistry-Paraffin: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/18398_TIMM8A-Antibody-(2F11)-Immunohistochemistry-Paraffin-H00001678-M01-img0005.jpg)
Immunohistochemistry-Paraffin: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of monoclonal antibody to TIMM8A on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
![Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody (M01), clone 2F11.Lane 1: TIMM8A transfected lysate(11 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/18399_TIMM8A%2520Antibody%2520(2F11)-Western%2520Blot-H00001678-M01-img0008.jpg)
Western Blot: TIMM8A Antibody (2F11) [H00001678-M01] - Analysis of TIMM8A expression in transfected 293T cell line by TIMM8A monoclonal antibody (M01), clone 2F11.Lane 1: TIMM8A transfected lysate(11 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: TIMM8A Antibody (2F11) [H00001678-M01] - Detection limit for recombinant GST tagged TIMM8A is approximately 0.3ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/18400_TIMM8A-Antibody-(2F11)-Sandwich-ELISA-H00001678-M01-img0006.jpg)
Sandwich ELISA: TIMM8A Antibody (2F11) [H00001678-M01] - Detection limit for recombinant GST tagged TIMM8A is approximately 0.3ng/ml as a capture antibody.