CD300a/LMIR1 Antibody
| Name | CD300a/LMIR1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84431 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CD300a/LMIR1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CD300A |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: CD300A Antibody [NBP1-84431] - staining of human cell line U-251MG shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4433_CD300A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84431-img0003.jpg)
![Immunohistochemistry-Paraffin: CD300A Antibody [NBP1-84431] - Staining of human liver shows strong cytoplasmic positivity in Kupffer cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4434_CD300A%2520Antibody-Immunohistochemistry-Paraffin-NBP1-84431-img0002.jpg)