CD300a/LMIR1 Recombinant Protein Antigen

Name CD300a/LMIR1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84431PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CD300a/LMIR1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CD300A
Sequence SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD300A. Source: E.coli Amino Acid Sequence: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Supplier Page Shop