beta Adducin Antibody
| Name | beta Adducin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33974 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLRVSKEQDHF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | beta Adducin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: beta Adducin Antibody [NBP2-33974] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6673_beta%2520Adducin%2520Antibody-Western%2520Blot-NBP2-33974-img0003.jpg)
Western Blot: beta Adducin Antibody [NBP2-33974] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunohistochemistry-Paraffin: beta Adducin Antibody [NBP2-33974] - Staining of human cerebral cortex shows distinct positivity in neuropil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6674_beta-Adducin-Antibody-Immunohistochemistry-Paraffin-NBP2-33974-img0001.jpg)
Immunohistochemistry-Paraffin: beta Adducin Antibody [NBP2-33974] - Staining of human cerebral cortex shows distinct positivity in neuropil.