OATP1B3/SLCO1B3/OATP8 Antibody
| Name | OATP1B3/SLCO1B3/OATP8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80980 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLCO1B3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cell line A-431 shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21101_OATP1B3-SLCO1B3-OATP8-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80980-img0004.jpg)
Immunocytochemistry/Immunofluorescence: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human cell line A-431 shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human liver shows strong membranous positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21102_OATP1B3-SLCO1B3-OATP8-Antibody-Immunohistochemistry-Paraffin-NBP1-80980-img0005.jpg)
Immunohistochemistry-Paraffin: OATP1B3/SLCO1B3/OATP8 Antibody [NBP1-80980] - Staining of human liver shows strong membranous positivity in hepatocytes.