BRUNOL6 Antibody
| Name | BRUNOL6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32050 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BRUNOL6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CELF6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: BRUNOL6 Antibody [NBP2-32050] - Staining of human bone marrow shows strong nuclear and cytoplasmic positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1925_BRUNOL6-Antibody-Immunohistochemistry-NBP2-32050-img0004.jpg)
Immunohistochemistry: BRUNOL6 Antibody [NBP2-32050] - Staining of human bone marrow shows strong nuclear and cytoplasmic positivity in hematopoietic cells.