AGTRAP Antibody
| Name | AGTRAP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91654 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | AGTRAP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AGTRAP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: AGTRAP Antibody [NBP1-91654] - Staining of human cell line A-431 shows positivity in vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13862_AGTRAP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91654-img0005.jpg)
![Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13863_AGTRAP-Antibody-Immunohistochemistry-Paraffin-NBP1-91654-img0002.jpg)