C1orf124 Antibody
| Name | C1orf124 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84163 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C1orf124 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SPRTN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C1orf124 Antibody [NBP1-84163] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22361_C1orf124%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84163-img0004.jpg)
Immunocytochemistry/Immunofluorescence: C1orf124 Antibody [NBP1-84163] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: C1orf124 Antibody [NBP1-84163] - Staining of human cerebellum shows distinct cytoplasmic positivity in purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22362_C1orf124-Antibody-Immunohistochemistry-Paraffin-NBP1-84163-img0002.jpg)
Immunohistochemistry-Paraffin: C1orf124 Antibody [NBP1-84163] - Staining of human cerebellum shows distinct cytoplasmic positivity in purkinje cells.