IFT20 Antibody

Name IFT20 Antibody
Supplier Novus Biologicals
Catalog NBP1-86424
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:MTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDK
Purity/Format Immunogen affinity purified
Blocking Peptide IFT20 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene IFT20
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.