Neogenin Antibody
| Name | Neogenin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89651 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Neogenin Protein |
| Description | Rabbit Polyclonal |
| Gene | NEO1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Neogenin Antibody [NBP1-89651] - Analysis in human cell line A-549.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6268_Neogenin-Antibody-Western-Blot-NBP1-89651-img0006.jpg)
Western Blot: Neogenin Antibody [NBP1-89651] - Analysis in human cell line A-549.
![Immunocytochemistry/Immunofluorescence: Neogenin Antibody [NBP1-89651] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6269_Neogenin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89651-img0007.jpg)
Immunocytochemistry/Immunofluorescence: Neogenin Antibody [NBP1-89651] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane.
![Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6270_Neogenin-Antibody-Immunohistochemistry-Paraffin-NBP1-89651-img0002.jpg)
Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.