MPST Antibody
| Name | MPST Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54734 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptides corresponding to MPST(mercaptopyruvate sulfurtransferase) The peptide sequence was selected from the middle region of MPST. Peptide sequence DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MPST |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MPST Antibody [NBP1-54734] - Lane 1 : 40 ug Human Liver lysate Lane 2: 40 ug Mouse Liver lysate Lane 3: 40 ug Rat Liver lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit Secondary Antibody conjugated with Alexa Fluor 647 Secondary, Antibody Dilution: 1 : 2500.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19851_MPST%2520Antibody-Western%2520Blot-NBP1-54734-img0003.jpg)
Western Blot: MPST Antibody [NBP1-54734] - Lane 1 : 40 ug Human Liver lysate Lane 2: 40 ug Mouse Liver lysate Lane 3: 40 ug Rat Liver lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit Secondary Antibody conjugated with Alexa Fluor 647 Secondary, Antibody Dilution: 1 : 2500.
![Western Blot: MPST Antibody [NBP1-54734] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19852_MPST-Antibody-Western-Blot-NBP1-54734-img0002.jpg)
Western Blot: MPST Antibody [NBP1-54734] - HepG2 cell lysate, concentration 0.2-1 ug/ml.