PALS1/MPP5 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54724
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to MPP5(membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)) The peptide sequence was selected from the N terminal of MPP5 (NP_071919.2). AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: MPP5
• Conjugate: Unconjugated

Product images

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.